PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Itr_sc000509.1_g00002.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Convolvulaceae; Ipomoeeae; Ipomoea
Family NAC
Protein Properties Length: 675aa    MW: 77085.6 Da    PI: 6.6549
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Itr_sc000509.1_g00002.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM181.12.7e-5661331128
                      NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratksgyWk 84 
                              lppGfrFhPtdeelv +yLk+k++g+k+el e+i+evd+yk+ePwdLp k  + +++ ewyfFs+rd+ky++g+r+nratk+gyWk
  Itr_sc000509.1_g00002.1   6 LPPGFRFHPTDEELVAYYLKRKINGRKIEL-EIIPEVDLYKCEPWDLPgKsLLPSKDLEWYFFSPRDRKYPNGSRTNRATKAGYWK 90 
                              79****************************.99***************6434555777**************************** PP

                      NAM  85 atgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                              atgkd++v s + + vg+kktLv+y+grap+g +tdWvmheyrl
  Itr_sc000509.1_g00002.1  91 ATGKDRKVNS-QMRSVGMKKTLVYYRGRAPHGARTDWVMHEYRL 133
                              **********.9999***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019415.36E-634156IPR003441NAC domain
PROSITE profilePS5100561.7096156IPR003441NAC domain
PfamPF023656.4E-307133IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 675 aa     Download sequence    Send to blast
MAPVSLPPGF RFHPTDEELV AYYLKRKING RKIELEIIPE VDLYKCEPWD LPGKSLLPSK  60
DLEWYFFSPR DRKYPNGSRT NRATKAGYWK ATGKDRKVNS QMRSVGMKKT LVYYRGRAPH  120
GARTDWVMHE YRLDERECEI QNGLQDAYAL CRVFKKSLTN TGPKMGDHYV SAASDRSSSM  180
DIYSEGRCEE MESSNYAMAA PPSSAAASCS SMAAAAVHGS PFHHVAAAGP STNDDKWMQY  240
LSDEAFSFHT PPPSSLPNYA TMPYPPSKVD IALECARLQH RFMLPQLEVQ DFPHVVGHVD  300
ARMIPHHHHQ SSFVNHDNNP DIVQEILSVA QASQDLMNQD GWGGGGGGYA PTAADDDFSF  360
LLPHNGSQFQ DMGNFRFMDQ LREDQNGGRN IEITDFGDEF KPDRMVENLR WVGMSDKDLE  420
KTLLEDYKAV PIENVSGFNR EGHEDHGESS QHNNFSDIND FSLGFDNNHD HNHNNNFLED  480
FSDSPSFEVY EKVEVKHGMF IASRQAAKTL YHQVVPSTTV RIHRNLLVPM QSATFPVSKF  540
EASRAFNNNN NIVLDKFIAF SRKMLIGIIK LTRPWRRMVS TLVGVIAILH TCWVYFGELL  600
LEAQEKNYYY CHFPREKREL SGDYEWESLK KNKDSSIADK KNPRMTTRVD KTTWPYLTLV  660
LALSTIWLHQ NVTFF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A2e-54115612165NO APICAL MERISTEM PROTEIN
1ut4_B2e-54115612165NO APICAL MERISTEM PROTEIN
1ut7_A2e-54115612165NO APICAL MERISTEM PROTEIN
1ut7_B2e-54115612165NO APICAL MERISTEM PROTEIN
4dul_A2e-54115612165NAC domain-containing protein 19
4dul_B2e-54115612165NAC domain-containing protein 19
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00212DAPTransfer from AT1G65910Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009790763.10.0PREDICTED: uncharacterized protein LOC104238166
TrEMBLA0A068U2960.0A0A068U296_COFCA; Uncharacterized protein
STRINGVIT_04s0079g00280.t010.0(Vitis vinifera)
STRINGPGSC0003DMT4000553220.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA14952348
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G65910.11e-144NAC domain containing protein 28